Abt1 Rabbit Polyclonal Antibody

CAT#: TA342312

Rabbit Polyclonal Anti-Abt1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Abt1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the c terminal of mouse Abt1. Synthetic peptide located within the following region: QEFRARKAARPGGRERARLANVEDQARSNRGLLAKIFGAPLPAESKEKP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name activator of basal transcription 1
Background Could be a novel TATA-binding protein (TBP) which can function as a basal transcription activator. Can act as a regulator of basal transcription for class II genes.
Synonyms hABT1
Note Immunogen Sequence Homology: Dog: 100%; Mouse: 100%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.