Antibodies

View as table Download

Rabbit anti-ABT1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABT1

Rabbit Polyclonal Anti-ABT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the middle region of human ABT1. Synthetic peptide located within the following region: EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR

Rabbit Polyclonal Anti-ABT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the N terminal of human ABT1. Synthetic peptide located within the following region: VGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRV

Rabbit Polyclonal Anti-Abt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the middle region of mouse Abt1. Synthetic peptide located within the following region: RQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTE

Rabbit Polyclonal Anti-Abt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the c terminal of mouse Abt1. Synthetic peptide located within the following region: QEFRARKAARPGGRERARLANVEDQARSNRGLLAKIFGAPLPAESKEKP