Activator of basal transcription 1 (ABT1) Rabbit Polyclonal Antibody

CAT#: TA329691

Rabbit Polyclonal Anti-ABT1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ABT1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the N terminal of human ABT1. Synthetic peptide located within the following region: VGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 32 kDa
Gene Name activator of basal transcription 1
Background Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by ABT1 likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA.
Synonyms hABT1
Note Immunogen sequence homology: Human: 100%; Bovine: 86%; Dog: 79%; Rabbit: 79%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.