Germany
Japan
United Kingdom
China
Rabbit anti-ABT1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABT1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ABT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the middle region of human ABT1. Synthetic peptide located within the following region: EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR |
Rabbit Polyclonal Anti-ABT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the N terminal of human ABT1. Synthetic peptide located within the following region: VGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRV |
Rabbit Polyclonal Anti-Abt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the middle region of mouse Abt1. Synthetic peptide located within the following region: RQRLRAEVAQAKRETDFYLRNVEQGQHFLAADGDATRPNSSWTFTQRPTE |
Rabbit Polyclonal Anti-Abt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Abt1 antibody: synthetic peptide directed towards the c terminal of mouse Abt1. Synthetic peptide located within the following region: QEFRARKAARPGGRERARLANVEDQARSNRGLLAKIFGAPLPAESKEKP |
Active filters
Target Symbol
- ABT1