HOXB9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB9 |
HOXB9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB9 |
HOXB9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB9 |
Rabbit polyclonal anti-HOXB9 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HOXB9. |
Rabbit Polyclonal Anti-Hoxb9 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Hoxb9 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb9. Synthetic peptide located within the following region: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSC |
Goat Anti-HOXB9 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CEGSEDKERPDQTN, from the internal region of the protein sequence according to NP_076922.1. |
Hoxb9 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
HOXB9 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXB9 |
HOXB9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human HOXB9 (NP_076922.1). |
Modifications | Unmodified |