Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-Rab8b Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8b produced in E. coli.

Rabbit Polyclonal Anti-RAB8B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB8B antibody: synthetic peptide directed towards the C terminal of human RAB8B. Synthetic peptide located within the following region: SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS

Rabbit Polyclonal Anti-RAB8B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB8B antibody: synthetic peptide directed towards the C terminal of human RAB8B. Synthetic peptide located within the following region: RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK

Rabbit Polyclonal Anti-RAB8B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAB8B

RAB8B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAB8B