RAB8B Rabbit Polyclonal Antibody

CAT#: TA342691

Rabbit Polyclonal Anti-RAB8B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RAB8B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAB8B antibody: synthetic peptide directed towards the C terminal of human RAB8B. Synthetic peptide located within the following region: SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name RAB8B, member RAS oncogene family
Background RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).
Synonyms FLJ38125
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.