RAB8B Rabbit Polyclonal Antibody

CAT#: TA342691

Rabbit Polyclonal Anti-RAB8B Antibody

Product Images

RAB8B antibody validated by WB using HepG2 cell lysate at 1 ug/ml.

• 

  Sample Type: 1. Human Cervical Cancer Cell Lysate (15ug); 2. Monkey Fibroblast Cell Lysate (15ug); 3. Human Cervical Cancer Cell transfected with mouse Rab8B-GFP (15ug); Primary Dilution: 1:1000; Secondary Antibody: goat anti-Rabbit; Secondary Dilution: 1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB8B antibody: synthetic peptide directed towards the C terminal of human RAB8B. Synthetic peptide located within the following region: SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: RAB8B, member RAS oncogene family
• Database Link:
  NP_057614
  Entrez Gene 235442 MouseEntrez Gene 51762 Human
  UniProt ID Q92930
• Background: RAB proteins, like RAB8B, are low molecular mass monomeric GTPases that localize on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB proteins function in intracellular vesicle transport by aiding in the docking and/or fusion of vesicles with their target membranes (summary by Chen et al., 1997 [PubMed 9030196]).
• Synonyms: FLJ38125
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome