Antibodies

Jump to Filters
View as table Download
COMT Rabbit Polyclonal Antibody
TA335255

USD 375.00

5 Days

Rabbit Polyclonal Anti-COMT Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COMT antibody: synthetic peptide directed towards the middle region of human COMT. Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH
COMT Rabbit Polyclonal Antibody
TA374984

USD 220.00

3 Weeks

COMT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 42-221 of human COMT (NP_009294.1).
Modifications Unmodified