Antibodies

Jump to Filters
View as table Download
PEAMT (PEMT) Rabbit Polyclonal Antibody
TA331635

USD 375.00

5 Days

Rabbit Polyclonal Anti-PEMT Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-PEMT Antibody: synthetic peptide directed towards the C terminal of human PEMT. Synthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS