PEAMT (PEMT) Rabbit Polyclonal Antibody

CAT#: TA331635

Rabbit Polyclonal Anti-PEMT Antibody

Product Images

Lanes: Lane 1: 20 ug rat liver lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 15000; Gene Name: PEMT; Submitted by: Anonymous;

• 

  Lanes: Lane 1: 20 ug rat liver lysate; Primary Antibody Dilution: 1: 2000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 15000; Gene Name: PEMT; Submitted by: Anonymous;

• 

  WB Suggested Anti-PEMT Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PEMT Antibody: synthetic peptide directed towards the C terminal of human PEMT. Synthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: phosphatidylethanolamine N-methyltransferase
• Database Link:
  NP_680477
  Entrez Gene 25511 RatEntrez Gene 10400 Human
  UniProt ID Q9UBM1
• Background: PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.
• Synonyms: PEAMT; PEMPT; PEMT2; PNMT
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Bovine: 93%; Dog: 86%; Pig: 86%; Guinea pig: 83%; Zebrafish: 82%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways