CAMSAP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CAMSAP3 |
CAMSAP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CAMSAP3 |
Rabbit Polyclonal Anti-CAMSAP3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CAMSAP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human CAMSAP3. Synthetic peptide located within the following region: APSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSN |
CAMSAP3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CAMSAP3 |