KIAA1543 (CAMSAP3) Rabbit Polyclonal Antibody

CAT#: TA331808

Rabbit Polyclonal Anti-CAMSAP3 Antibody

Product Images

Host: Rabbit; Target Name: CAMSAP3; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CAMSAP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human CAMSAP3. Synthetic peptide located within the following region: APSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 137 kDa
• Gene Name: calmodulin regulated spectrin associated protein family member 3
• Database Link:
  NP_065953
  Entrez Gene 57662 Human
  UniProt ID Q9P1Y5
• Background: Microtubule minus-end binding protein that acts as a regulator of microtubule dynamics. CAMSAP3 is specifically required for zonula adherens biogenesis and maintenance by anchoring microtubules at their minus-ends to zonula adherens, leading to recruit KIFC3 kinesin to junctional site.
• Synonyms: KIAA1543; NEZHA; PPP1R80
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 79%