Antibodies

View as table Download

HOXD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human HOXD1

Rabbit Polyclonal Anti-HOXD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD1 antibody: synthetic peptide directed towards the middle region of human HOXD1. Synthetic peptide located within the following region: QNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEP

Rabbit Polyclonal Anti-HOXD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD1 antibody: synthetic peptide directed towards the C terminal of human HOXD1. Synthetic peptide located within the following region: LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ

HOXD1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 13-43 amino acids from the N-terminal region of Human HOXD1 / HOX4G

Rabbit Polyclonal Anti-HOXD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD1 antibody: synthetic peptide directed towards the C terminal of human HOXD1. Synthetic peptide located within the following region: LTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQ