Antibodies

Jump to Filters
View as table Download
P5CS (ALDH18A1) Goat Polyclonal Antibody
TA311248

USD 375.00

2 Weeks

Goat Anti-ALDH18A1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-SEHGSLKYLH, from the C Terminus of the protein sequence according to NP_002851.2; NP_001017423.1.
P5CS (ALDH18A1) Rabbit Polyclonal Antibody
TA336073

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALDH18A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH18A1 Antibody: synthetic peptide directed towards the N terminal of human ALDH18A1. Synthetic peptide located within the following region: SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR
P5CS (ALDH18A1) Rabbit Polyclonal Antibody
TA373435

USD 220.00

3 Weeks

ALDH18A1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human ALDH18A1 (NP_002851.2).
Modifications Unmodified