P5CS (ALDH18A1) Rabbit Polyclonal Antibody

CAT#: TA336073

Rabbit Polyclonal Anti-ALDH18A1 Antibody

Product Images

WB Suggested Anti-ALDH18A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysateALDH18A1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ALDH18A1 Antibody: synthetic peptide directed towards the N terminal of human ALDH18A1. Synthetic peptide located within the following region: SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: aldehyde dehydrogenase 18 family member A1
• Database Link:
  NP_001017423
  Entrez Gene 5832 Human
  UniProt ID P54886
• Background: This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases.This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases. Alternatively spliced transcript variants, encoding different isoforms, have been described for this gene.
• Synonyms: ARCL3A; GSAS; P5CS; PYCS
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 92%; Mouse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways