Rabbit polyclonal Mlf1 phospho T78 antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Bovine, Chimpanzee, Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids surrounding Thr78 of human MLF1IP protein. The immunogen peptide is phosphorylated at Thr78. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CENPU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLF1IP antibody is: synthetic peptide directed towards the C-terminal region of Human MLF1IP. Synthetic peptide located within the following region: ISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHL |
Rabbit polyclonal anti-MLF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a 200 residue recombinant protein corresponding to the amino terminal end of human MLF1IP protein. |
Rabbit polyclonal anti-MLF1 antibody
| Applications | WB |
| Reactivities | Bovine, Chimpanzee, Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids surrounding Thr78 of human MLF1IP protein. |
Rabbit polyclonal MLF1IP / PBIP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a 418 residue recombinant protein corresponding to the carboxy terminal end of human MLF1IP protein. |
Rabbit Polyclonal Anti-CENPU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLF1IP antibody is: synthetic peptide directed towards the N-terminal region of Human MLF1IP. Synthetic peptide located within the following region: IYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPG |
Rabbit Polyclonal Anti-CENPU Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CENPU |
CENPU Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CENPU |
CENPU Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CENPU |
CENPU rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CENPU |
Germany
Japan
United Kingdom
China
