Antibodies

Jump to Filters
View as table Download
Caspr (CNTNAP1) Rabbit Polyclonal Antibody
TA338227

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNTNAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTNAP1 antibody: synthetic peptide directed towards the N terminal of human CNTNAP1. Synthetic peptide located within the following region: LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS
CNTNAP1 Rabbit Polyclonal Antibody
TA367939

USD 380.00

4 Weeks

CNTNAP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNTNAP1
Caspr (CNTNAP1) Rabbit Polyclonal Antibody
TA374942

USD 220.00

3 Weeks

Caspr1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human Caspr1 (NP_003623.1).
Modifications Unmodified