Antibodies

Jump to Filters
View as table Download
DNAAF4 Goat Polyclonal Antibody
TA302996

USD 375.00

5 Days

Goat Polyclonal Antibody against DYX1C1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIRNVIQGTELKS, from the C Terminus of the protein sequence according to NP_570722.2.
DNAAF4 Goat Polyclonal Antibody
TA305792

USD 375.00

5 Days

Goat Anti-DYX1C1 / EKN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PLQVSDYSWQQTKT-C, from the N Terminus of the protein sequence according to NP_570722.2; NP_001028731.1; NP_001028732.1.
DNAAF4 Rabbit Polyclonal Antibody
TA340262

USD 375.00

5 Days

Rabbit Polyclonal Anti-DYX1C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the C terminal of human DYX1C1. Synthetic peptide located within the following region: FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA
DNAAF4 Rabbit Polyclonal Antibody
TA340263

USD 375.00

5 Days

Rabbit Polyclonal Anti-DYX1C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the middle region of human DYX1C1. Synthetic peptide located within the following region: TDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEK