Germany
Japan
United Kingdom
China
Goat Anti-MDG1 / DNAJB9 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RGNMVTTYTDCSGQ, from the C Terminus of the protein sequence according to NP_036460.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-DNAJB9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAJB9 antibody: synthetic peptide directed towards the N terminal of human DNAJB9. Synthetic peptide located within the following region: MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA |
DNAJB9 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNAJB9 |
DNAJB9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-223 of human DNAJB9 (NP_036460.1). |
| Modifications | Unmodified |
Active filters
Category
- Antibodies
Target Symbol
- DNAJB9