Antibodies

View as table Download

Rabbit Polyclonal antibody to Edc3 (enhancer of mRNA decapping 3 homolog (S. cerevisiae))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 127 and 376 of Edc3 (Uniprot ID#Q96F86)

Rabbit Polyclonal Anti-EDC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDC3 antibody is: synthetic peptide directed towards the middle region of Human EDC3. Synthetic peptide located within the following region: KKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDT

EDC3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 159-508 of human EDC3 (NP_079359.2).
Modifications Unmodified

EDC3 phospho S161 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen EDC3 affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic phospho-peptide surrounding the pS161 site of mouse EDC3.