Antibodies

View as table Download

Anti-FOXS1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal anti-Fkhl18 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Fkhl18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQKQPSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMG

Rabbit Polyclonal Anti-Foxs1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Fkhl18 antibody: synthetic peptide directed towards the c terminal of mouse Fkhl18. Synthetic peptide located within the following region: MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA

Anti-FOXS1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

FOXS1 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FOXS1

FOXS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 121-330 of human FOXS1 (NP_004109.1).
Modifications Unmodified