Antibodies

View as table Download

Cytokeratin 10 (KRT10) guinea pig polyclonal antibody, Serum

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide of Human Keratin K10 (formerly also designated Cytokeratin 10; C-GS VGE SSS KGP RY), coupled to KLH

Rabbit Polyclonal antibody to Cytokeratin 10 (keratin 10)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 73 and 284 of Cytokeratin 10

Rabbit Polyclonal Anti-KRT10 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KRT10 antibody: synthetic peptide directed towards the N terminal of human KRT10. Synthetic peptide located within the following region: EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD

Rabbit polyclonal Keratin 10 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Keratin 10.

Rabbit Polyclonal Anti-Keratin 10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Keratin 10 Antibody: A synthesized peptide derived from human Keratin 10

Anti-KRT10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 570-584 amino acids of human keratin 10

Mouse anti Keratin 10/13 Monoclonal Antibody

Applications IHC, WB
Reactivities Feline, Human, Rat

Cytokeratin 10 (KRT10) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human KRT10

Cytokeratin 10 (KRT10) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human KRT10

Anti-KRT10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 10

Anti-KRT10 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 570-584 amino acids of human keratin 10

KRT10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human KRT10
Modifications Unmodified

Cytokeratin 10 Mouse monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from human Cytokeratin 10

Cytokeratin 10 Mouse monoclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from human Cytokeratin 10