Antibodies

Jump to Filters
View as table Download
ME2 Rabbit Polyclonal Antibody
TA372529

USD 380.00

4 Weeks

ME2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ME2
ME2 (C-term) Rabbit Polyclonal Antibody
AP52647PU-N

USD 450.00

2 Weeks

ME2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 526-556 amino acids from the C-terminal region of Human NAD-ME
ME2 Rabbit Polyclonal Antibody
TA339737

USD 375.00

5 Days

Rabbit Polyclonal Anti-ME2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ME2 antibody: synthetic peptide directed towards the N terminal of human ME2. Synthetic peptide located within the following region: MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG
ME2 Rabbit Polyclonal Antibody
TA368291

USD 380.00

4 Weeks

ME2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ME2
ME2 Rabbit Polyclonal Antibody
TA378422

USD 220.00

3 Weeks

ME2 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-479 of human ME2 (NP_001161807.1).
Modifications Unmodified
ME2 Rabbit Monoclonal Antibody [Clone ID: R04-7I2]
TA384772

USD 380.00

4 Weeks

ME2 Rabbit monoclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated