Antibodies

Jump to Filters
View as table Download
NOX5 Rabbit Polyclonal Antibody
TA315785

USD 345.00

4 Weeks

Rabbit polyclonal anti-NOX5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5.
NOX5 Goat Polyclonal Antibody
TA311523

USD 375.00

5 Days

Goat Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EWHPFTISSAPEQKD, from the internal region of the protein sequence according to NP_078781.3; NP_001171708.1; NP_001171709.1.
NOX5 Rabbit Polyclonal Antibody
TA338656

USD 375.00

5 Days

Rabbit Polyclonal Anti-NOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human NOX5. Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG
NOX5 Rabbit Polyclonal Antibody
TA350234

USD 345.00

In Stock

Rabbit Polyclonal Anti-NOX5 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NOX5
NOX5 Rabbit Polyclonal Antibody
TA369242

USD 380.00

4 Weeks

NOX5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NOX5
NOX5 Rabbit Polyclonal Antibody
TA379242

USD 220.00

3 Weeks

NOX5 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 661-765 of human NOX5 (NP_078781.3).
Modifications Unmodified