Rabbit anti-PDLIM5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDLIM5 |
Rabbit anti-PDLIM5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDLIM5 |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDLIM5 Antibody: synthetic peptide directed towards the middle region of human PDLIM5. Synthetic peptide located within the following region: RTGTTQSRSFRILAQITGTEHLKESEADNTKKANNSQEPSPQLASSVAST |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDLIM5 Antibody: synthetic peptide directed towards the middle region of human PDLIM5. Synthetic peptide located within the following region: VKIPPKRPPRKHIVERYTEFYHVPTHSDASKKRLIEDTEDWRPRTGTTQS |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the N terminal of human PDLIM5. Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL |
Rabbit Polyclonal Anti-PDLIM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDLIM5 antibody: synthetic peptide directed towards the C terminal of human PDLIM5. Synthetic peptide located within the following region: AGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF |
Carrier-free (BSA/glycerol-free) PDLIM5 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDLIM5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDLIM5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDLIM5 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDLIM5 |
PDLIM5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDLIM5 |
PDLIM5 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
PDLIM5 mouse monoclonal antibody,clone 1B5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDLIM5 mouse monoclonal antibody,clone 1B5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDLIM5 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDLIM5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDLIM5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDLIM5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDLIM5 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDLIM5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDLIM5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDLIM5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDLIM5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PDLIM5 mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |