Rabbit Polyclonal Anti-PRMT3 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK |
Goat Anti-PRMT3 (aa468-421) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence DPKTLISEPCGIKH, from the internal region of the protein sequence according to NP_005779.1; NP_001138638.1; NP_001138639.1. |
Rabbit Polyclonal Anti-PRMT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS |
PRMT3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PRMT3 (NP_005779.1). |
| Modifications | Unmodified |
PRMT3 Rabbit monoclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Recombinant Anti-PRMT3 (Clone RAB-C372)
| Applications | ChIP, ELISA |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-PRMT3 (Clone RAB-C372)
| Applications | ChIP, ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
