Rabbit Polyclonal Anti-REPIN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REPIN1 antibody: synthetic peptide directed towards the middle region of human REPIN1. Synthetic peptide located within the following region: VSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTF |
Rabbit Polyclonal Anti-REPIN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-REPIN1 antibody: synthetic peptide directed towards the middle region of human REPIN1. Synthetic peptide located within the following region: GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGG |
REPIN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human REPIN1. |
Germany
Japan
United Kingdom
China