AP4 (REPIN1) Rabbit Polyclonal Antibody

CAT#: TA329692

Rabbit Polyclonal Anti-REPIN1 Antibody

Product Images

WB Suggested Anti-REPIN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-REPIN1 antibody: synthetic peptide directed towards the middle region of human REPIN1. Synthetic peptide located within the following region: GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: replication initiator 1
• Database Link:
  NP_037532
  Entrez Gene 29803 Human
  UniProt ID Q9BWE0
• Background: Sequence-specific double-stranded DNA-binding protein required for initiation of chromosomal DNA replication. REPIN1 binds on 5'-ATT-3' reiterated sequences downstream of the origin of bidirectional replication (OBR) and a second, homologous ATT sequence of opposite orientation situated within the OBR zone. REPIN1 facilitates DNA bending.
• Synonyms: AP4; RIP60; Zfp464; ZNF464
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Yeast: 80%