Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GPR58 / TAAR2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TAAR2 / GPR58 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human TAAR2. Percent identity with other species by BLAST analysis: Human (100%); Marmoset (83%). |
Rabbit polyclonal TAAR2 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TAAR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TAAR2. |
Rabbit Polyclonal Anti-TAAR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAAR2 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR2. Synthetic peptide located within the following region: ENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLF |
TAAR2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TAAR2 |
Active filters
Category
- Antibodies
Target Symbol
- TAAR2