Antibodies

Jump to Filters
View as table Download
TMEM9 Rabbit Polyclonal Antibody
TA342012

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMEM9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM9 antibody: synthetic peptide directed towards the C terminal of human TMEM9. Synthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS
TMEM9 Rabbit Polyclonal Antibody
TA366140

USD 380.00

4 Weeks

TMEM9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMEM9
TMEM9 Rabbit Polyclonal Antibody
TA370494

USD 380.00

4 Weeks

TMEM9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TMEM9