TMEM9 Rabbit Polyclonal Antibody

CAT#: TA342012

Rabbit Polyclonal Anti-TMEM9 Antibody

Product Images

WB Suggested Anti-TMEM9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM9 antibody: synthetic peptide directed towards the C terminal of human TMEM9. Synthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: transmembrane protein 9
• Database Link:
  NP_057540
  Entrez Gene 252839 Human
  UniProt ID Q9P0T7
• Background: May be involved in intracellular transport.
• Synonyms: TMEM9A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane