Antibodies

Jump to Filters
View as table Download
TSPAN1 Rabbit Polyclonal Antibody
TA307931

USD 415.00

5 Days

Rabbit polyclonal antibody to Tetraspan 1 (tetraspanin 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 132 and 227 of Tetraspan 1 (Uniprot ID#O60635)
TSPAN1 Rabbit Polyclonal Antibody
TA307929

USD 415.00

5 Days

Rabbit polyclonal antibody to tetraspan 1 (tetraspanin 1)

Applications WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 76 and 168 of Tetraspan 1 (Uniprot ID#O60635)
TSPAN1 Rabbit Polyclonal Antibody
TA332053

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSPAN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSPAN1 Antibody: synthetic peptide directed towards the middle region of human TSPAN1. Synthetic peptide located within the following region: TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA
TSPAN1 Mouse Monoclonal Antibody [Clone ID: 4/12]
TA386338

USD 523.00

2 Weeks

Recombinant Anti-Tetraspanin 1 (Clone 4/12)

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
TSPAN1 Rabbit Monoclonal Antibody [Clone ID: 4/12]
TA386339

USD 523.00

2 Weeks

Recombinant Anti-Tetraspanin 1 (Clone 4/12)

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.