Rabbit Polyclonal Anti-ZNF398 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF398 antibody: synthetic peptide directed towards the N terminal of human ZNF398. Synthetic peptide located within the following region: AEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQ |
Rabbit Polyclonal Anti-ZNF398 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF398 antibody: synthetic peptide directed towards the C terminal of human ZNF398. Synthetic peptide located within the following region: GCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL |
Rabbit Polyclonal Anti-ZNF398 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF398 Antibody: synthetic peptide directed towards the middle region of human ZNF398. Synthetic peptide located within the following region: NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC |
ZNF398 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-230 of human ZNF398 (NP_733787.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
