Antibodies

Jump to Filters
View as table Download
S adenosylhomocysteine hydrolase (AHCY) Rabbit Polyclonal Antibody
TA332593

USD 275.00

In Stock

Rabbit anti-AHCY Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AHCY
DNMT3A Rabbit Polyclonal Antibody
TA346818

USD 475.00

5 Days

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE
BHMT (391-402) Goat Polyclonal Antibody
AP22552PU-N

USD 440.00

2 Weeks

BHMT (391-402) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Hamster, Human, Monkey, Rat
Immunogen Synthetic peptide from C-term of human BHMT
CBS Rabbit Polyclonal Antibody
TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE