BHMT (391-402) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Hamster, Human, Monkey, Rat |
Immunogen | Synthetic peptide from C-term of human BHMT |
BHMT (391-402) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Hamster, Human, Monkey, Rat |
Immunogen | Synthetic peptide from C-term of human BHMT |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |