Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Mouse Anti-Human CD34 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-SOX2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2 |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT2 |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-CDX2 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD4 mouse monoclonal antibody, clone OTI10B5 (formerly 10B5)
| Applications | WB |
| Reactivities | Human, Monkey, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD8A mouse monoclonal antibody,clone OTI3H6
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD4 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CDX2 mouse monoclonal antibody,clone OTI3B1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD34 mouse monoclonal antibody, clone OTI51A1 (formerly 51A1)
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
APOE mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD34 mouse monoclonal antibody, clone OTI11E1 (formerly 11E1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Families
- Adult stem cells
Citations
- Yes
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Hematopoietic cell lineage (22)
- Cell adhesion molecules (CAMs) (20)
- Antigen processing and presentation (15)
- Primary immunodeficiency (13)
- T cell receptor signaling pathway (13)
- Pathways in cancer (9)
- Hedgehog signaling pathway (7)
- Basal cell carcinoma (6)
- Dorso-ventral axis formation (5)
- MAPK signaling pathway (5)
- TGF-beta signaling pathway (5)
- ECM-receptor interaction (4)
- Endocytosis (4)
- Alzheimer's disease (3)
- Cytokine-cytokine receptor interaction (3)
- Melanoma (3)
- Notch signaling pathway (3)
- Prion diseases (3)
- Regulation of actin cytoskeleton (3)
- Wnt signaling pathway (3)
- Adherens junction (2)
- Allograft rejection (2)
- Autoimmune thyroid disease (2)
- Bladder cancer (2)
- Calcium signaling pathway (2)
- Colorectal cancer (2)
- Endometrial cancer (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- ErbB signaling pathway (2)
- Focal adhesion (2)
- Gap junction (2)
- Glioma (2)
- GnRH signaling pathway (2)
- Graft-versus-host disease (2)
- Huntington's disease (2)
- Melanogenesis (2)
- Neurotrophin signaling pathway (2)
- Non-small cell lung cancer (2)
- Pancreatic cancer (2)
- Prostate cancer (2)
- Type I diabetes mellitus (2)
- Ubiquitin mediated proteolysis (2)
- Viral myocarditis (2)
- Jak-STAT signaling pathway (1)
- Maturity onset diabetes of the young (1)