Antibodies

Jump to Filters
View as table Download
E2F1 Rabbit Polyclonal Antibody
TA308764

USD 415.00

2 Weeks

Rabbit polyclonal antibody to E2F1 (E2F transcription factor 1)

Applications IF, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 133 and 362 of E2F1 (Uniprot ID#Q01094)
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA332108

USD 375.00

5 Days

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI