Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody

CAT#: TA332108

Rabbit Polyclonal Anti-RXRA Antibody

Product Images

Host: Rabbit; Target Name: RXRA; Sample Tissue: Human MCF7; Antibody Dilution: 1.0ug/ml; RXRA is strongly supported by BioGPS gene expression data to be expressed in MCF7

• 

  Host: Rabbit; Target Name: RXRA; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: RXRA; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: RXRA; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: RXRA; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  WB Suggested Anti-RXRA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: HepG2 cell lysate; RXRA is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Show all 6 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: retinoid X receptor alpha
• Database Link:
  NP_002948
  Entrez Gene 6256 Human
  UniProt ID P19793
• Background: Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. RXRA is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators.Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: NR2B1
• Note: Immunogen sequence homology: Human: 100%; Dog: 88%; Pig: 88%; Rat: 88%; Mouse: 88%; Guinea pig: 88%; Bovine: 75%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Adipocytokine signaling pathway, Non-small cell lung cancer, Pathways in cancer, PPAR signaling pathway, Small cell lung cancer, Thyroid cancer