Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K9me2 Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9me2 antibody: the region of histone H3 containing the dimethylated lysine 9 (H3K9me2), using a KLH-conjugated synthetic peptide. |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-C4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM |
USD 300.00
In Stock
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
USD 540.00
2 Weeks
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, PerCP-Cy5.5
| Applications | FC |
| Reactivities | Human |
| Conjugation | PerCP-Cy5.5 |
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-SSB mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | FC, IF, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Pathways
- Systemic lupus erythematosus
Citations
- Yes