Antibodies

Jump to Filters
View as table Download
Angpt2 (C-term) Rabbit Polyclonal Antibody
AP23297PU-N

USD 330.00

2 Weeks

Angpt2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping near the C-terminal  (454-468) of Human Angiopoietin-2.
Angiopoietin 2 (ANGPT2) Rabbit Polyclonal Antibody
TA343276

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ANGPT2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG