Antibodies

View as table Download

Rabbit polyclonal anti-XRCC1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human XRCC1.

Rabbit polyclonal XRCC1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This XRCC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 407-435 amino acids from the Central region of human XRCC1.

Rabbit Polyclonal Anti-XRCC1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-XRCC1 Antibody: A synthesized peptide derived from human XRCC1

Rabbit Polyclonal Anti-XRCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-XRCC1 antibody is: synthetic peptide directed towards the C-terminal region of Human XRCC1. Synthetic peptide located within the following region: GDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLP