Rabbit polyclonal anti-XRCC1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human XRCC1. |
Rabbit polyclonal anti-XRCC1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human XRCC1. |
Rabbit polyclonal XRCC1 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This XRCC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 407-435 amino acids from the Central region of human XRCC1. |
Rabbit Polyclonal Anti-XRCC1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-XRCC1 Antibody: A synthesized peptide derived from human XRCC1 |
Rabbit Polyclonal Anti-XRCC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-XRCC1 antibody is: synthetic peptide directed towards the C-terminal region of Human XRCC1. Synthetic peptide located within the following region: GDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLP |