Rabbit Polyclonal Anti-Htr3a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Htr3a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH |
Anti-GLRA1/GLRA2/GLRA3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human glycine receptor, alpha 1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Anti-GABRR1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of Human gamma-aminobutyric acid (GABA) A receptor, rho 1 |
Rabbit Polyclonal Anti-CHRNA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CHRNA1 |
Rabbit Polyclonal Anti-HTR3B Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HTR3B |
CHRNA6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GABRG3 Antibody - N-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GABRG3 |
Germany
Japan
United Kingdom
China
