Rabbit Polyclonal Anti-SNAI1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAI1 |
Rabbit Polyclonal Anti-SNAI1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAI1 |
Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human: Ser246, Mouse: Ser246 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M). |
Modifications | Phospho-specific |
Rabbit anti-Snail Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Snail |
Rabbit Polyclonal SNAI1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SNAI1 |
Rabbit polyclonal anti-SNAI1 (Ab-246) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M) |
Rabbit Polyclonal SNAI1 (Ser246) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SNAI1 around the phosphorylation site of Serine 246 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SNAI1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL |
Rabbit Polyclonal Anti-SNAI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SNAI1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNAI1. Synthetic peptide located within the following region: RKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLP |