SNAIL (SNAI1) Rabbit Polyclonal Antibody

CAT#: TA333929

Rabbit Polyclonal Anti-SNAI1 Antibody

Product Images

Host: Rabbit; Target Name: SNAI1; Sample Tissue: NCI-H226 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SNAI1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNAI1. Synthetic peptide located within the following region: RKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: snail family transcriptional repressor 1
• Database Link:
  NP_005976
  Entrez Gene 6615 Human
  UniProt ID O95863
• Background: The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.
• Synonyms: dJ710H13.1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Pig: 85%; Horse: 85%; Guinea pig: 85%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction