Antibodies

View as table Download

Rabbit polyclonal SLC11A2 Antibody (Center)

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2.

Rabbit Polyclonal Anti-SLC11A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC11A2 Antibody: synthetic peptide directed towards the N terminal of human SLC11A2. Synthetic peptide located within the following region: VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF

SLC11A2 / DMT1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen SLC11A2 / DMT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Galago, Rat, Hamster, Bovine, Horse (94%); Mouse, Elephant (88%); Dog, Bat, Rabbit, Pig, Guinea pig (81%).

SLC11A2 / DMT1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen SLC11A2 / DMT1 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Pig (93%); Dog, Rabbit (87%); Marmoset, Panda (80%).

Rabbit Polyclonal Anti-SLC11A2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC11A2