Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Anti-SLC11A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC11A2 Antibody: synthetic peptide directed towards the N terminal of human SLC11A2. Synthetic peptide located within the following region: VLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYF |
SLC11A2 / DMT1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | SLC11A2 / DMT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Galago, Rat, Hamster, Bovine, Horse (94%); Mouse, Elephant (88%); Dog, Bat, Rabbit, Pig, Guinea pig (81%). |
SLC11A2 / DMT1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Human |
| Conjugation | Unconjugated |
| Immunogen | SLC11A2 / DMT1 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC11A2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Pig (93%); Dog, Rabbit (87%); Marmoset, Panda (80%). |
DMT1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DMT1 (NP_000608.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
