Rabbit anti-AP2B1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AP2B1 |
Rabbit anti-AP2B1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AP2B1 |
Rabbit Polyclonal Beta 2 Adaptin Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Rabbit Polyclonal Anti-AP2B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP |
Rabbit Polyclonal Anti-AP2B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the C terminal of human AP2B1. Synthetic peptide located within the following region: GAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVV |
Rabbit Polyclonal Anti-AP2B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI |
AP2B1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AP2B1 |