AP2B1 Rabbit Polyclonal Antibody

CAT#: TA336045

Rabbit Polyclonal Anti-AP2B1 Antibody

Product Images

WB Suggested Anti-AP2B1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 105 kDa
• Gene Name: adaptor related protein complex 2 beta 1 subunit
• Database Link:
  NP_001025177
  Entrez Gene 163 Human
  UniProt ID P63010
• Background: AP2B1is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: ADTB2; AP2-BETA; AP105B; CLAPB1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis, Huntington's disease