Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Beta 2 Adaptin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
AP2B1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 516-546 amino acids from the Central region of human AP2B1 |
Rabbit Polyclonal Anti-AP2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP |
Rabbit Polyclonal Anti-AP2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the C terminal of human AP2B1. Synthetic peptide located within the following region: GAVDLLGGGLDSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVV |
Rabbit Polyclonal Anti-AP2B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AP2B1 Antibody: synthetic peptide directed towards the middle region of human AP2B1. Synthetic peptide located within the following region: DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI |
AP2B1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AP2B1 |
Active filters
Target Symbol
- AP2B1