Antibodies

Jump to Filters
View as table Download
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA306502

USD 430.00

In Stock

Rabbit Polyclonal ZBP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZBP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human ZBP1.
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA590283

USD 409.00

In Stock

Rabbit Polyclonal Z DNA binding protein Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Z DNA binding protein (ZBP1) Rabbit Polyclonal Antibody
TA341712

USD 310.00

5 Days

Rabbit Polyclonal Anti-ZBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBP1 antibody: synthetic peptide directed towards the middle region of human ZBP1. Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG